PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo19G0014300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 193aa    MW: 22112.9 Da    PI: 7.0444
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo19G0014300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l ++++ +G g W+t ar  g++Rt+k+c++rw++yl
  Spipo19G0014300 15 KGPWTIEEDLILMNYIANHGEGVWNTLARSAGLKRTGKSCRLRWLNYL 62
                     79********************************************97 PP

2Myb_DNA-binding54.62.5e-1768111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+++++ ++G++ W++Iar ++ gRt++++k++w++
  Spipo19G0014300  68 RGNITPEEQLLIIELHSRWGNR-WSKIARQLP-GRTDNEIKNYWRT 111
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.5221062IPR017930Myb domain
SuperFamilySSF466892.13E-3012109IPR009057Homeodomain-like
SMARTSM007173.8E-111464IPR001005SANT/Myb domain
PfamPF002492.3E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-221669IPR009057Homeodomain-like
CDDcd001672.72E-91762No hitNo description
PROSITE profilePS5129425.85663117IPR017930Myb domain
SMARTSM007175.9E-1567115IPR001005SANT/Myb domain
PfamPF002491.6E-1568111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2470117IPR009057Homeodomain-like
CDDcd001675.31E-1272111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MDKKASTSHD PDIRKGPWTI EEDLILMNYI ANHGEGVWNT LARSAGLKRT GKSCRLRWLN  60
YLRPDVRRGN ITPEEQLLII ELHSRWGNRW SKIARQLPGR TDNEIKNYWR TRIQKKIKDD  120
HHFDYQQPAP AFEGSAGDQM MSVEDCGVSK SSPVCSTINN DLGGLLMGTP SGEPNDGFWT  180
LEDFWSMQMF SSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27111173108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008812482.16e-87PREDICTED: myb-related protein 305-like
SwissprotP813911e-81MYB05_ANTMA; Myb-related protein 305
TrEMBLK9LXH51e-83K9LXH5_9ASPA; R2R3 MYB
STRINGVIT_14s0066g01090.t012e-81(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.11e-71myb domain protein 24